PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G273800.1.p
Common NameSb04g031110, SORBIDRAFT_04g031110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 389aa    MW: 41050.6 Da    PI: 4.3004
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G273800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161663148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rg+WT++Ed +l+ +++++G  +W++ ++  g+ R++k+c++rw +yl
  Sobic.004G273800.1.p 16 RGSWTPQEDMRLIAYIQKHGHANWRALPKQAGLLRCGKSCRLRWINYL 63
                          89******************************99************97 PP

2Myb_DNA-binding50.35.4e-1669114148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg++T++E+e +++++ +lG++ W++Ia++++ gRt++++k+ w+++l
  Sobic.004G273800.1.p  69 RGNFTADEEETIIRLHGLLGNK-WSKIAACLP-GRTDNEIKNVWNTHL 114
                           89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.361163IPR017930Myb domain
SuperFamilySSF466892.02E-2913110IPR009057Homeodomain-like
SMARTSM007171.1E-121565IPR001005SANT/Myb domain
PfamPF002494.1E-151663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-231770IPR009057Homeodomain-like
CDDcd001671.87E-101863No hitNo description
PROSITE profilePS5129424.45164118IPR017930Myb domain
SMARTSM007174.9E-1468116IPR001005SANT/Myb domain
PfamPF002492.7E-1469114IPR001005SANT/Myb domain
CDDcd001677.15E-1171114No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2571117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MGRGRAPCCA KVGLNRGSWT PQEDMRLIAY IQKHGHANWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDLKRG NFTADEEETI IRLHGLLGNK WSKIAACLPG RTDNEIKNVW NTHLKKKKQV  120
APREEQKAGA AADKNDDDGA ASGEAGTPAT AASSSASSST TTTTTNNSSA GSDNSGDQCG  180
TSREPDVIDA SLLQLEDIDV SDMLVDAPPA AAQPCQAPML SSPCSSSSLT TTCVGGGVEE  240
LIELPVIEIE PEIWSIIDGE SATDAPDASG GGTAPCTGTA AVVSTSEAEE AAAANDWWLE  300
NLEKELGLWG PAEDTQAAHP DLLDHIAAGF SPLGALELER DPVSTYFQTA PAVGEPELMV  360
AEPSAVLLRV INEQQEGTDP FRPVEIEG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-271411725127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ5609790.0FJ560979.1 Saccharum hybrid cultivar Co 86032 MYB transcription factor (MYB21) pseudogene, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002452709.10.0hypothetical protein SORBIDRAFT_04g031110
SwissprotP200241e-172MYB1_MAIZE; Myb-related protein Zm1
TrEMBLC5Y0G70.0C5Y0G7_SORBI; Putative uncharacterized protein Sb04g031110
STRINGSb04g031110.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.13e-66myb domain protein 63